Viewing Single Post From: Needle In The Haystack Cipher

Viewing Single Post From: Needle In The Haystack Cipher
Revelation	Apr 28 2008, 03:18 PM
Administrator Posts: 386 Group: Admin Member #1 Joined: August 23, 2005	Quote: a clock keyed cipher That would mean that the receiver would know at what time the message is sent. This means that the header of the encrypted message is not encrypted with that key, else the receiver can't recognise the header. I was thinking of another way to change the key: just keep encrypting it. If the first message is sent, both the sender and the receiver have got the same key. When the sender wants to send something, he encrypts the key. The receiver has done the same, so he can still check for the header. This way the header is never the same. The question still remains: could Eve find the header? If the header is just a few bytes long, there is a possibility that the random bits give a correct header. If the sender wants to prevent that, he should filter the header sequence. That could help Eve. He could also make the header longer, but I am not sure if that would help a cryptoanalyst.
	RRRREJMEEEEEPVKLWENFNVJKEEEEEAOLKAFKLXCFZAASDJXZTTTTTTTLSIOWJXMOKLAFJNNKFNXN RAGRBAQEMHIGDJVDSEOXVIYCELFHWLELJFIENXLRATALSJFSLCYTKLASJDKMHGOVOKAJDNMNUITN RRRRLJVEEEEECLYVYHNVPFTAEEEEEMWLMEIRNGLARWJAKJDFLWNTIERJMIPQWOTZEOCXKNUBNXCN RJIRPOWEANFUSNCZVDVZNMSFEKLOEPZLDKDJWSAAAAAAAOERHJCTNCKFRIMVKSOFOMKMANREWNBN RZUDRGXEEEEENFQIDVLQNCKNEEEEEDGLLLLLLAWIOSNCDARLODMTOEJXMILDFJROTKJSDNLVCZNN

Needle In The Haystack Cipher · General