Welcome Guest [Log In] [Register]
Viewing Single Post From: Brute Forcing The Adfgvx Cipher
Revelation Apr 28 2008, 07:09 PM
Member Avatar
Administrator
[ * * * * * ]
Quote:
 
Then we just try various transpositions until our digram frequency looks like a mono substitution frequency. And that undoes step 2. From there, any polybius square will convert the remaining crypt text into a mono alphabetic substitution, which is easy to solve. Brilliant! And NICE!!!!


That's what I suggested in my second and third post and that's what my application would do: first sweeping the pattern of a crib through the text and then checking the frequency of the bigrams (btw, I haven't started writing it yet)

Your other sequence is a pain, especially if you use two different squares in step 1 and 3. I'm not sure how to solve that.
RRRREJMEEEEEPVKLWENFNVJKEEEEEAOLKAFKLXCFZAASDJXZTTTTTTTLSIOWJXMOKLAFJNNKFNXN
RAGRBAQEMHIGDJVDSEOXVIYCELFHWLELJFIENXLRATALSJFSLCYTKLASJDKMHGOVOKAJDNMNUITN
RRRRLJVEEEEECLYVYHNVPFTAEEEEEMWLMEIRNGLARWJAKJDFLWNTIERJMIPQWOTZEOCXKNUBNXCN
RJIRPOWEANFUSNCZVDVZNMSFEKLOEPZLDKDJWSAAAAAAAOERHJCTNCKFRIMVKSOFOMKMANREWNBN
RZUDRGXEEEEENFQIDVLQNCKNEEEEEDGLLLLLLAWIOSNCDARLODMTOEJXMILDFJROTKJSDNLVCZNN
Offline Profile Quote Post
Brute Forcing The Adfgvx Cipher · General