| Welcome to Crypto. We hope you enjoy your visit. You're currently viewing our forum as a guest. This means you are limited to certain areas of the board and there are some features you can't use. If you join our community, you'll be able to access member-only sections, and use many member-only features such as customizing your profile, sending personal messages, and voting in polls. Registration is simple, fast, and completely free. Join our community! If you're already a member please log in to your account to access all of our features: |
| Cryptoforum Outage | |
|---|---|
| Tweet Topic Started: Sep 15 2005, 03:02 PM (1,023 Views) | |
| insecure | Sep 15 2005, 03:02 PM Post #1 |
|
NSA worthy
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
The Crypto Forum server dropped off the Net for a short time today. Unconfirmed reports suggested that the domain could not be reached. Wild allegations of denial of service (DoS) attacks by the NSA and GCHQ have met with a stony silence from those agencies. Interference caused by the communications signals of invading alien spacecraft has not yet been discounted as a factor. Or did your mother unplug the server so she could get on with some vacuum-cleaning?
|
![]() |
|
| PulsarSL | Sep 15 2005, 07:16 PM Post #2 |
|
Super member
![]() ![]() ![]() ![]() ![]() ![]()
|
lol |
![]() |
|
| Donald | Sep 15 2005, 10:07 PM Post #3 |
|
NSA worthy
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
What you don't realize is that Revelation's mother works for the NSA! Donald -Just because I'm paranoid doesn't mean they aren't out to get me! |
![]() |
|
| PulsarSL | Sep 16 2005, 01:50 AM Post #4 |
|
Super member
![]() ![]() ![]() ![]() ![]() ![]()
|
lol x 2 |
![]() |
|
| Revelation | Sep 16 2005, 01:13 PM Post #5 |
|
Administrator
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
LMAO
If I had more members, i'd ban you It is probably the NSA, they still haven't figured out my challenge
|
|
RRRREJMEEEEEPVKLWENFNVJKEEEEEAOLKAFKLXCFZAASDJXZTTTTTTTLSIOWJXMOKLAFJNNKFNXN RAGRBAQEMHIGDJVDSEOXVIYCELFHWLELJFIENXLRATALSJFSLCYTKLASJDKMHGOVOKAJDNMNUITN RRRRLJVEEEEECLYVYHNVPFTAEEEEEMWLMEIRNGLARWJAKJDFLWNTIERJMIPQWOTZEOCXKNUBNXCN RJIRPOWEANFUSNCZVDVZNMSFEKLOEPZLDKDJWSAAAAAAAOERHJCTNCKFRIMVKSOFOMKMANREWNBN RZUDRGXEEEEENFQIDVLQNCKNEEEEEDGLLLLLLAWIOSNCDARLODMTOEJXMILDFJROTKJSDNLVCZNN | |
![]() |
|
| cows | Oct 10 2005, 05:03 PM Post #6 |
|
Unregistered
|
Stupid Mums
|
|
|
| insecure | Oct 11 2005, 07:50 AM Post #7 |
|
NSA worthy
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
Don't ever make the mistake of thinking a mum is stupid. |
![]() |
|
| cows | Oct 11 2005, 03:12 PM Post #8 |
|
Unregistered
|
I didn't mean it like that. Mum's rock. They do all sorts and are very wise. |
|
|
| 1 user reading this topic (1 Guest and 0 Anonymous) | |
| « Previous Topic · News · Next Topic » |





![]](http://z2.ifrm.com/static/1/pip_r.png)



It is probably the NSA, they still haven't figured out my challenge
Stupid Mums
12:53 AM Jul 11