Welcome Guest [Log In] [Register]
Welcome to Crypto. We hope you enjoy your visit.


You're currently viewing our forum as a guest. This means you are limited to certain areas of the board and there are some features you can't use. If you join our community, you'll be able to access member-only sections, and use many member-only features such as customizing your profile, sending personal messages, and voting in polls. Registration is simple, fast, and completely free.


Join our community!


If you're already a member please log in to your account to access all of our features:

Username:   Password:
Add Reply
Cryptoforum Outage
Topic Started: Sep 15 2005, 03:02 PM (1,023 Views)
insecure
NSA worthy
[ *  *  *  *  *  * ]
The Crypto Forum server dropped off the Net for a short time today. Unconfirmed reports suggested that the domain could not be reached. Wild allegations of denial of service (DoS) attacks by the NSA and GCHQ have met with a stony silence from those agencies. Interference caused by the communications signals of invading alien spacecraft has not yet been discounted as a factor.

Or did your mother unplug the server so she could get on with some vacuum-cleaning? :D
Offline Profile Quote Post Goto Top
 
PulsarSL
Super member
[ *  *  *  * ]
insecure
Sep 15 2005, 03:02 PM
The Crypto Forum server dropped off the Net for a short time today. Unconfirmed reports suggested that the domain could not be reached. Wild allegations of denial of service (DoS) attacks by the NSA and GCHQ have met with a stony silence from those agencies. Interference caused by the communications signals of invading alien spacecraft has not yet been discounted as a factor.

Or did your mother unplug the server so she could get on with some vacuum-cleaning? :D

lol
Offline Profile Quote Post Goto Top
 
Donald
NSA worthy
[ *  *  *  *  *  * ]
Quote:
 
Or did your mother unplug the server so she could get on with some vacuum-cleaning?

What you don't realize is that Revelation's mother works for the NSA!

Donald

-Just because I'm paranoid doesn't mean they aren't out to get me!
Offline Profile Quote Post Goto Top
 
PulsarSL
Super member
[ *  *  *  * ]
Donald
Sep 15 2005, 10:07 PM
Quote:
 
Or did your mother unplug the server so she could get on with some vacuum-cleaning?

What you don't realize is that Revelation's mother works for the NSA!

Donald

-Just because I'm paranoid doesn't mean they aren't out to get me!

lol x 2
Offline Profile Quote Post Goto Top
 
Revelation
Member Avatar
Administrator
[ *  *  *  *  * ]
LMAO :P
If I had more members, i'd ban you ;) It is probably the NSA, they still haven't figured out my challenge :D
RRRREJMEEEEEPVKLWENFNVJKEEEEEAOLKAFKLXCFZAASDJXZTTTTTTTLSIOWJXMOKLAFJNNKFNXN
RAGRBAQEMHIGDJVDSEOXVIYCELFHWLELJFIENXLRATALSJFSLCYTKLASJDKMHGOVOKAJDNMNUITN
RRRRLJVEEEEECLYVYHNVPFTAEEEEEMWLMEIRNGLARWJAKJDFLWNTIERJMIPQWOTZEOCXKNUBNXCN
RJIRPOWEANFUSNCZVDVZNMSFEKLOEPZLDKDJWSAAAAAAAOERHJCTNCKFRIMVKSOFOMKMANREWNBN
RZUDRGXEEEEENFQIDVLQNCKNEEEEEDGLLLLLLAWIOSNCDARLODMTOEJXMILDFJROTKJSDNLVCZNN
Offline Profile Quote Post Goto Top
 
cows
Unregistered

Quote:
 
Or did your mother unplug the server so she could get on with some vacuum-cleaning?


:lol: Stupid Mums
Quote Post Goto Top
 
insecure
NSA worthy
[ *  *  *  *  *  * ]
Don't ever make the mistake of thinking a mum is stupid.
Offline Profile Quote Post Goto Top
 
cows
Unregistered

I didn't mean it like that. Mum's rock. They do all sorts and are very wise.
Quote Post Goto Top
 
1 user reading this topic (1 Guest and 0 Anonymous)
« Previous Topic · News · Next Topic »
Add Reply