Pattern Word Dictionary

Welcome to Crypto. We hope you enjoy your visit.

You're currently viewing our forum as a guest. This means you are limited to certain areas of the board and there are some features you can't use. If you join our community, you'll be able to access member-only sections, and use many member-only features such as customizing your profile, sending personal messages, and voting in polls. Registration is simple, fast, and completely free.

Join our community!

If you're already a member please log in to your account to access all of our features:

Pages:
1
2

Pattern Word Dictionary; Available for download
Topic Started: Oct 4 2005, 07:43 PM (938 Views)
Donald	Oct 4 2005, 07:43 PM Post #1
Elite member Posts: 454 Group: Trusted Member Member #8 Joined: September 2, 2005	Fiziwig has kindly made the best pattern word dictionary I have ever seen available for download again!!! http://fiziwig.com/pattern.html Using a pattern word dictionary is easy (as Insecure as pointed out). First figure out what the "pattern" of your word is. Code: `PATTERN <-0rig word ABCCDEF <-Pattern COOL <-0rig word ABBC <-Pattern FIZIWIG <-Orig word ABCBDBE <-Pattern` Lets go over the word fiziwig in detail, just to make certain it's clear. F <-first letter is always A I <-this is a new letter, so it is assigned the next letter in sequence, B Z <-Another new letter, so this one is C I <-Ah! We've seen I before, so we use the same letter, B again W <-new letter, it gets D (because we've used AB and C so far) I <-I again, so still B G <-new letter, this one gets E pattern=ABCBDBE you look up that pattern in the pattern dictionary, and possible word matches are listed below. Nifty! don't leave home without it! Donald



Revelation	Oct 4 2005, 08:19 PM Post #2
Administrator Posts: 386 Group: Admin Member #1 Joined: August 23, 2005	I don't think it is that hard to make, but it sure is a great idea
	RRRREJMEEEEEPVKLWENFNVJKEEEEEAOLKAFKLXCFZAASDJXZTTTTTTTLSIOWJXMOKLAFJNNKFNXN RAGRBAQEMHIGDJVDSEOXVIYCELFHWLELJFIENXLRATALSJFSLCYTKLASJDKMHGOVOKAJDNMNUITN RRRRLJVEEEEECLYVYHNVPFTAEEEEEMWLMEIRNGLARWJAKJDFLWNTIERJMIPQWOTZEOCXKNUBNXCN RJIRPOWEANFUSNCZVDVZNMSFEKLOEPZLDKDJWSAAAAAAAOERHJCTNCKFRIMVKSOFOMKMANREWNBN RZUDRGXEEEEENFQIDVLQNCKNEEEEEDGLLLLLLAWIOSNCDARLODMTOEJXMILDFJROTKJSDNLVCZNN


rot13	Oct 4 2005, 08:27 PM Post #3
Elite member Posts: 306 Group: Trusted Member Member #14 Joined: September 29, 2005	I once hacked together a program to search multiple patterns at the same time. The program is pretty dumb and can't handle words longer than 12 characters. Also, it slows down considerably with more than a few words. It helps if you choose patterns with lots of overlapping letters. The file is available at: http://www.wutka.com/download/patterns.zip It is a command-line program and was written in C. It should compile and run easily under Linux, and if you have Cygwin, it should be fine on Windows. By default, it uses a short list of valid scrabble words, but I also included a longer list of english words. Here is an example: patterns ABCDEFGBHDIC GBHDI The program might run for 30 seconds or more, but should spit out: CRYPTOGRAPHY GRAPH To use the longer dictionary, use the -d option: patterns -d english.txt ABCDEFGBHDIC GBHDI



Donald	Oct 4 2005, 09:06 PM Post #4
Elite member Posts: 454 Group: Trusted Member Member #8 Joined: September 2, 2005	"Revelation" I don't think it is that hard to make, but it sure is a great idea The main issue is how much text you have run through it. Fiziwigs dictionary has a lot of very obscure words, which I find VERY nice. "rot13" I once hacked together a program to search multiple patterns at the same time. Cool! I gotta get a c compiler working on my windows box. Or, I've got a dual boot system, perhaps I should just boot up to linux and compile it there. Either way, lots of stuff for me to play with sometime in the near future. Donald



insecure	Oct 4 2005, 09:14 PM Post #5
Elite member Posts: 381 Group: Trusted Member Member #10 Joined: September 9, 2005	Not that I wish to discourage you from booting into Linux, but here are six free C compilers for Windows or MS-DOS: http://www.borland.com/downloads/download_cbuilder.html http://community.borland.com/article/0,1410,20841,00.html http://www.delorie.com/djgpp/ http://www.mingw.org/ http://www.digitalmars.com/ http://msdn.microsoft.com/visualc/vctoolkit2003/ I cannot recommend the last one! :-)



rot13	Oct 4 2005, 09:18 PM Post #6
Elite member Posts: 306 Group: Trusted Member Member #14 Joined: September 29, 2005	Donald Oct 4 2005, 09:06 PM The main issue is how much text you have run through it. Fiziwigs dictionary has a lot of very obscure words, which I find VERY nice. The list of scrabble words has some pretty obscure words. It has about 152,000 words. The english.txt file has twice that. It would be nice to merge fiziwig's in with it and see how many it adds.



insecure	Oct 4 2005, 09:23 PM Post #7
Elite member Posts: 381 Group: Trusted Member Member #10 Joined: September 9, 2005	In Linux that's easy enough. Assuming you have two dictionary files, A.txt and B.txt, each with one word per line: Code: `cat A.txt \| wc -l cat B.txt \| wc -l cat A.txt B.txt \| sort \| uniq \| wc -l`



rot13	Oct 4 2005, 09:35 PM Post #8
Elite member Posts: 306 Group: Trusted Member Member #14 Joined: September 29, 2005	insecure Oct 4 2005, 09:23 PM In Linux that's easy enough. Assuming you have two dictionary files, A.txt and B.txt, each with one word per line: Code: `cat A.txt \| wc -l cat B.txt \| wc -l cat A.txt B.txt \| sort \| uniq \| wc -l` yes, but fiziwig's dictionary wasn't just a list of words, it has the pattern, followed by the words. I used sed to get it fixed up. Fiziwig's file contains about 95,000 words. When merged with each of the dictionary files I use, it added about 50,000 to them.



Donald	Oct 4 2005, 09:39 PM Post #9
Elite member Posts: 454 Group: Trusted Member Member #8 Joined: September 2, 2005	"rot13" When merged with each of the dictionary files I use, it added about 50,000 to them. Cool. Fiziwig told me, specifically, "Feel free to use it any way you like." "Insecure" here are six free C compilers for Windows or MS-DOS: Thanks! I appreciate it. I got python down late last night, so, time to leave the old dialup account running all night again and bring down one of these. Donald



PulsarSL	Oct 4 2005, 09:56 PM Post #10
Super member Posts: 157 Group: Members Member #7 Joined: September 1, 2005	I've been thinking about making one of these just for fun. Project Gutenburg seems like a good source of words. Edit: I read fiziwig's site and it says he did use Gutenburg.



rot13	Oct 4 2005, 09:59 PM Post #11
Elite member Posts: 306 Group: Trusted Member Member #14 Joined: September 29, 2005	There are quite a few lists for various languages here: http://www.cryptogram.org/cdb/words/words.html



insecure	Oct 6 2005, 08:52 AM Post #12
Elite member Posts: 381 Group: Trusted Member Member #10 Joined: September 9, 2005	Just went for the Fiziwig dictionary. No sign of floccinaucinihilipilification or antidisestablishmentarianism. How lame. :-) Seriously, quite a handy resource. All I have to do now is rip those patterns out, to leave the actual words behind. Fortunately, they are all in upper case, which makes my life a lot easier.



John K. Taber	Nov 4 2005, 06:40 PM Post #13
Unregistered	I wrote a pattern word dictionary search program integrated with an aristocrat solver some years ago. It is still available at several sites. Here is an ftp site in Finland: funet. Look for taber-crypt201. The program is entirely in ASM, and source is included. One version of the handbook is hard coded for a dot matrix printer, but the ascii version, and I think the MS Word version should be good. John
Unregistered


Donald	Nov 6 2005, 03:12 AM Post #14
Elite member Posts: 454 Group: Trusted Member Member #8 Joined: September 2, 2005	Cool, thanks for the link!



Revelation	Nov 7 2005, 01:40 PM Post #15
Administrator Posts: 386 Group: Admin Member #1 Joined: August 23, 2005	Thanks I will check the source too, because my ASM is not that good!
	RRRREJMEEEEEPVKLWENFNVJKEEEEEAOLKAFKLXCFZAASDJXZTTTTTTTLSIOWJXMOKLAFJNNKFNXN RAGRBAQEMHIGDJVDSEOXVIYCELFHWLELJFIENXLRATALSJFSLCYTKLASJDKMHGOVOKAJDNMNUITN RRRRLJVEEEEECLYVYHNVPFTAEEEEEMWLMEIRNGLARWJAKJDFLWNTIERJMIPQWOTZEOCXKNUBNXCN RJIRPOWEANFUSNCZVDVZNMSFEKLOEPZLDKDJWSAAAAAAAOERHJCTNCKFRIMVKSOFOMKMANREWNBN RZUDRGXEEEEENFQIDVLQNCKNEEEEEDGLLLLLLAWIOSNCDARLODMTOEJXMILDFJROTKJSDNLVCZNN


1 user reading this topic (1 Guest and 0 Anonymous)


Go to Next Page
« Previous Topic · General · Next Topic »

Pages:
1
2