| Welcome to Crypto. We hope you enjoy your visit. You're currently viewing our forum as a guest. This means you are limited to certain areas of the board and there are some features you can't use. If you join our community, you'll be able to access member-only sections, and use many member-only features such as customizing your profile, sending personal messages, and voting in polls. Registration is simple, fast, and completely free. Join our community! If you're already a member please log in to your account to access all of our features: |
| Activity | |
|---|---|
| Tweet Topic Started: Mar 24 2006, 07:44 PM (1,084 Views) | |
| Revelation | Mar 24 2006, 07:44 PM Post #1 |
|
Administrator
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
Hi there members, Since there haven't been any posts in a long while, I want to bring this forum back to life. So.. if anyone has a challenge, please post it! I know you are all probably very busy these days, the same thing goes for me. But if you find some spare time, don't be afraid to post a challenge. Your beloved admin ;), Revelation |
|
RRRREJMEEEEEPVKLWENFNVJKEEEEEAOLKAFKLXCFZAASDJXZTTTTTTTLSIOWJXMOKLAFJNNKFNXN RAGRBAQEMHIGDJVDSEOXVIYCELFHWLELJFIENXLRATALSJFSLCYTKLASJDKMHGOVOKAJDNMNUITN RRRRLJVEEEEECLYVYHNVPFTAEEEEEMWLMEIRNGLARWJAKJDFLWNTIERJMIPQWOTZEOCXKNUBNXCN RJIRPOWEANFUSNCZVDVZNMSFEKLOEPZLDKDJWSAAAAAAAOERHJCTNCKFRIMVKSOFOMKMANREWNBN RZUDRGXEEEEENFQIDVLQNCKNEEEEEDGLLLLLLAWIOSNCDARLODMTOEJXMILDFJROTKJSDNLVCZNN | |
![]() |
|
| insecure | Mar 25 2006, 02:48 PM Post #2 |
|
NSA worthy
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
Some of us are still checking in occasionally to see if anything's going on. But partly yes, we're busy, and partly there's not much for us to do. There's no point in just posting for the sake of posting. There are already several unanswered challenges on the site (including two of mine, I think). Why post more, until at least some progress has been made with those? |
![]() |
|
| Donald | Mar 26 2006, 02:18 PM Post #3 |
|
NSA worthy
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
Heh. I'm not certain we are GOING to get much further with Diego. Despite some promising beginings, It's a pretty solid cipher. I've got a routine I want to try against it that I THINK will identify a few particular strings, but I'm afraid that once I've done that, it won't actually HELP much further with breaking the entire cipher. But yeah, I've been BUSY. But not to busy for SOME cipher play. I've got the diego idea I hope to show some results on sometime, and I've written an emulator for a new mechanical cipher that was inspired by Diego. Gotta finish up a nice GUI for it and then I'll be posting that for your consideration. So we haven't forgotten this forum. Besides, trying to read sci.crypt right now is a NIGHTMARE. <sigh> |
![]() |
|
| insecure | Mar 29 2006, 08:04 AM Post #4 |
|
NSA worthy
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
Well, there was the Insecure Block Cipher, which is way harder than Diego, I think. I have hopes for cracking Diego - although I think it'll involve a computer. I would guess a paper crack isn't going to happen. But of course I don't mean brute force. (Pointless, with a keyspace of 25!) |
![]() |
|
| Donald | Mar 29 2006, 01:43 PM Post #5 |
|
NSA worthy
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
Ha! No one, to my knowledge, has made any progress on my "Impractical-1" known plaintext challenge. And THAT should be easier than your block cipher. (although rot13 did lay out a plan of attack) It's amazing how secure simple ciphers can be. Not that I'd TRUST them mind you, but they ARE a pain to break. I'm completely stumped and dead ended on the Block Cipher. I've decided that cracking block ciphers is just out of my leauge for now.
The vulnerability I'm trying to exploit certainly requires a computer, but it will only work against certain spots in the crypt text where interesting patterns occur. I think I can identify sequences of plain text in those cases. But then if I can reproduce the rest of the square from there is a big question.
Brute force against Diego wouldn't actually be 25!. Thats a problem with mixed alphabets, the keyspace is actually much smaller because they are usually created with keywords. The nice thing about Diego is that it doesn't eliminate duplicate letters from the key. I'm trying to modify my "Tornado" mixed alphabet system to USE duplicate letters in the key so you aren't throwing away entropy. |
![]() |
|
| insecure | Mar 29 2006, 04:38 PM Post #6 |
|
NSA worthy
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
The challenge cipher was not created using a keyword. It was created by a monkey (well, an honorary monkey) on a keyboard. Quite a different proposition. |
![]() |
|
| Donald | Mar 29 2006, 04:42 PM Post #7 |
|
NSA worthy
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
Ohhh! well, that puts it back to 25! then! Obviously a handy monkey to have around. I DO hope that he will type the same sequence for the field agents though...
|
![]() |
|
| insecure | Mar 29 2006, 09:19 PM Post #8 |
|
NSA worthy
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
I am given to understand that they are required to commit the gibberish to memory before their parachute jump. |
![]() |
|
| insecure | Mar 30 2006, 12:41 AM Post #9 |
|
NSA worthy
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
Oh, perhaps I should clarify that, in my Diego challenge, it was the key material which was generated like vfnkoank;vadvznuuenbfnkfld;szfnrwmtgdsa;f this, not the plaintext message! |
![]() |
|
| 1 user reading this topic (1 Guest and 0 Anonymous) | |
| « Previous Topic · News · Next Topic » |





![]](http://z2.ifrm.com/static/1/pip_r.png)



12:53 AM Jul 11