| Welcome to Crypto. We hope you enjoy your visit. You're currently viewing our forum as a guest. This means you are limited to certain areas of the board and there are some features you can't use. If you join our community, you'll be able to access member-only sections, and use many member-only features such as customizing your profile, sending personal messages, and voting in polls. Registration is simple, fast, and completely free. Join our community! If you're already a member please log in to your account to access all of our features: |
| How Did You Find Out About...; ... The Crypto Forum | |
|---|---|
| Topic Started: Jul 27 2006, 09:11 PM (412 Views) | |
| PulsarSL | Jul 27 2006, 09:11 PM Post #1 |
|
Super member
![]() ![]() ![]() ![]() ![]() ![]()
|
Like Revelation said, it's coming up on the Crypto Forum's one year anniversary. I thought it might be interesting to see how the members found out about this forum. It may also help Revelation decide how to advertise the forum if he so decides. Personally, I saw Rev's post here in sci.crypt. Pulsar |
![]() |
|
| oblivion | Jul 28 2006, 07:53 AM Post #2 |
|
Oblivious
![]() ![]() ![]() ![]()
|
I Googled for a forum like this for days before I found what I was looking for. I can't even recreate the exact Google search so the URL is carefully written down on a piece of paper in case anything happens to my computer. Maybe a domin-name is a good idea, so it is easy to find your way here. Let me know if you want me to chip in a couple of $ for a domain-name guys. |
|
The following statement is true. The previous statment is false. | |
![]() |
|
| rot13 | Jul 28 2006, 10:11 AM Post #3 |
|
Elite member
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
Yep, I found it via the sci.crypt post as well. |
![]() |
|
| Guest | Jul 28 2006, 10:26 AM Post #4 |
|
Unregistered
|
I can get a domain for around $6 if you're interested. |
|
|
| PulsarSL | Jul 28 2006, 10:28 AM Post #5 |
|
Super member
![]() ![]() ![]() ![]() ![]() ![]()
|
^ that would be me. I hate guest post. |
![]() |
|
| insecure | Jul 28 2006, 11:23 AM Post #6 |
|
Elite member
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
I saw it on Usenet too, albeit in rec.puzzles rather than sci.crypt. |
![]() |
|
| Donald | Jul 28 2006, 12:24 PM Post #7 |
|
Elite member
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
sci.crypt for me. |
![]() |
|
| Revelation | Aug 1 2006, 12:06 PM Post #8 |
|
Administrator
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
I bet it is very hard to find this forum on Google!
PulsarSL, have you got a link? |
|
RRRREJMEEEEEPVKLWENFNVJKEEEEEAOLKAFKLXCFZAASDJXZTTTTTTTLSIOWJXMOKLAFJNNKFNXN RAGRBAQEMHIGDJVDSEOXVIYCELFHWLELJFIENXLRATALSJFSLCYTKLASJDKMHGOVOKAJDNMNUITN RRRRLJVEEEEECLYVYHNVPFTAEEEEEMWLMEIRNGLARWJAKJDFLWNTIERJMIPQWOTZEOCXKNUBNXCN RJIRPOWEANFUSNCZVDVZNMSFEKLOEPZLDKDJWSAAAAAAAOERHJCTNCKFRIMVKSOFOMKMANREWNBN RZUDRGXEEEEENFQIDVLQNCKNEEEEEDGLLLLLLAWIOSNCDARLODMTOEJXMILDFJROTKJSDNLVCZNN | |
![]() |
|
| PulsarSL | Aug 1 2006, 08:36 PM Post #9 |
|
Super member
![]() ![]() ![]() ![]() ![]() ![]()
|
Well, not really... I have the developer hosting package from 1and1.com Domains are $6 with this package... So I could buy it and forward it to s13.invisionfree.com. Pulsar |
![]() |
|
| loki | Aug 10 2006, 02:06 PM Post #10 |
|
Advanced Member
![]() ![]() ![]() ![]() ![]()
|
I found this on google, but I don't remember what the search was. |
| c(x) = 3x3 + x2 + x + 2; Find the inverse | |
![]() |
|
| 1 user reading this topic (1 Guest and 0 Anonymous) | |
| « Previous Topic · Community · Next Topic » |





![]](http://209.85.122.85/static/1/pip_r.png)



12:50 AM Nov 28