How Did You Find Out About...

Welcome to Crypto. We hope you enjoy your visit.

You're currently viewing our forum as a guest. This means you are limited to certain areas of the board and there are some features you can't use. If you join our community, you'll be able to access member-only sections, and use many member-only features such as customizing your profile, sending personal messages, and voting in polls. Registration is simple, fast, and completely free.

Join our community!

If you're already a member please log in to your account to access all of our features:

How Did You Find Out About...; ... The Crypto Forum
Topic Started: Jul 27 2006, 09:11 PM (405 Views)
PulsarSL	Jul 27 2006, 09:11 PM Post #1
Super member Posts: 157 Group: Members Member #7 Joined: September 1, 2005	Like Revelation said, it's coming up on the Crypto Forum's one year anniversary. I thought it might be interesting to see how the members found out about this forum. It may also help Revelation decide how to advertise the forum if he so decides. Personally, I saw Rev's post here in sci.crypt. Pulsar



oblivion	Jul 28 2006, 07:53 AM Post #2
Oblivious Posts: 43 Group: Members Member #55 Joined: June 21, 2006	I Googled for a forum like this for days before I found what I was looking for. I can't even recreate the exact Google search so the URL is carefully written down on a piece of paper in case anything happens to my computer. Maybe a domin-name is a good idea, so it is easy to find your way here. Let me know if you want me to chip in a couple of $ for a domain-name guys.
	The following statement is true. The previous statment is false.


rot13	Jul 28 2006, 10:11 AM Post #3
Elite member Posts: 306 Group: Trusted Member Member #14 Joined: September 29, 2005	PulsarSL Jul 27 2006, 09:11 PM Like Revelation said, it's coming up on the Crypto Forum's one year anniversary. I thought it might be interesting to see how the members found out about this forum. It may also help Revelation decide how to advertise the forum if he so decides. Personally, I saw Rev's post here in sci.crypt. Pulsar Yep, I found it via the sci.crypt post as well.



Guest	Jul 28 2006, 10:26 AM Post #4
Unregistered	I can get a domain for around $6 if you're interested.
Unregistered


PulsarSL	Jul 28 2006, 10:28 AM Post #5
Super member Posts: 157 Group: Members Member #7 Joined: September 1, 2005	^ that would be me. I hate guest post.



insecure	Jul 28 2006, 11:23 AM Post #6
Elite member Posts: 381 Group: Trusted Member Member #10 Joined: September 9, 2005	I saw it on Usenet too, albeit in rec.puzzles rather than sci.crypt.



Donald	Jul 28 2006, 12:24 PM Post #7
Elite member Posts: 454 Group: Trusted Member Member #8 Joined: September 2, 2005	sci.crypt for me.



Revelation	Aug 1 2006, 12:06 PM Post #8
Administrator Posts: 386 Group: Admin Member #1 Joined: August 23, 2005	I bet it is very hard to find this forum on Google! Quote: I can get a domain for around $6 if you're interested. PulsarSL, have you got a link?
	RRRREJMEEEEEPVKLWENFNVJKEEEEEAOLKAFKLXCFZAASDJXZTTTTTTTLSIOWJXMOKLAFJNNKFNXN RAGRBAQEMHIGDJVDSEOXVIYCELFHWLELJFIENXLRATALSJFSLCYTKLASJDKMHGOVOKAJDNMNUITN RRRRLJVEEEEECLYVYHNVPFTAEEEEEMWLMEIRNGLARWJAKJDFLWNTIERJMIPQWOTZEOCXKNUBNXCN RJIRPOWEANFUSNCZVDVZNMSFEKLOEPZLDKDJWSAAAAAAAOERHJCTNCKFRIMVKSOFOMKMANREWNBN RZUDRGXEEEEENFQIDVLQNCKNEEEEEDGLLLLLLAWIOSNCDARLODMTOEJXMILDFJROTKJSDNLVCZNN


PulsarSL	Aug 1 2006, 08:36 PM Post #9
Super member Posts: 157 Group: Members Member #7 Joined: September 1, 2005	Revelation Aug 1 2006, 12:06 PM I bet it is very hard to find this forum on Google! Quote: I can get a domain for around $6 if you're interested. PulsarSL, have you got a link? Well, not really... I have the developer hosting package from 1and1.com Domains are $6 with this package... So I could buy it and forward it to s13.invisionfree.com. Pulsar



loki	Aug 10 2006, 02:06 PM Post #10
Advanced Member Posts: 87 Group: Members Member #48 Joined: April 28, 2006	I found this on google, but I don't remember what the search was.
	c(x) = 3x3 + x2 + x + 2; Find the inverse


1 user reading this topic (1 Guest and 0 Anonymous)


« Previous Topic · Community · Next Topic »