Welcome Guest [Log In] [Register]
Welcome to Crypto. We hope you enjoy your visit.


You're currently viewing our forum as a guest. This means you are limited to certain areas of the board and there are some features you can't use. If you join our community, you'll be able to access member-only sections, and use many member-only features such as customizing your profile, sending personal messages, and voting in polls. Registration is simple, fast, and completely free.


Join our community!


If you're already a member please log in to your account to access all of our features:

Username:   Password:
Add Reply
How Did You Find Out About...; ... The Crypto Forum
Topic Started: Jul 27 2006, 09:11 PM (411 Views)
PulsarSL
Super member
[ *  *  *  * ]
Like Revelation said, it's coming up on the Crypto Forum's one year anniversary. I thought it might be interesting to see how the members found out about this forum. It may also help Revelation decide how to advertise the forum if he so decides.


Personally, I saw Rev's post here in sci.crypt.

Pulsar
Offline Profile Quote Post Goto Top
 
oblivion
Member Avatar
Oblivious
[ *  * ]
I Googled for a forum like this for days before I found what I was looking for.
I can't even recreate the exact Google search so the URL is carefully written down on a piece of paper in case anything happens to my computer.

Maybe a domin-name is a good idea, so it is easy to find your way here.
Let me know if you want me to chip in a couple of $ for a domain-name guys.
The following statement is true.
The previous statment is false.
Offline Profile Quote Post Goto Top
 
rot13
Elite member
[ *  *  *  *  * ]
PulsarSL
Jul 27 2006, 09:11 PM
Like Revelation said, it's coming up on the Crypto Forum's one year anniversary. I thought it might be interesting to see how the members found out about this forum. It may also help Revelation decide how to advertise the forum if he so decides.


Personally, I saw Rev's post here in sci.crypt.

Pulsar

Yep, I found it via the sci.crypt post as well.
Offline Profile Quote Post Goto Top
 
Guest
Unregistered

I can get a domain for around $6 if you're interested.
Quote Post Goto Top
 
PulsarSL
Super member
[ *  *  *  * ]
^ that would be me.

I hate guest post.
Offline Profile Quote Post Goto Top
 
insecure
Elite member
[ *  *  *  *  * ]
I saw it on Usenet too, albeit in rec.puzzles rather than sci.crypt.
Offline Profile Quote Post Goto Top
 
Donald
Elite member
[ *  *  *  *  * ]
sci.crypt for me.
Offline Profile Quote Post Goto Top
 
Revelation
Member Avatar
Administrator
[ *  *  *  *  * ]
I bet it is very hard to find this forum on Google!

Quote:
 
I can get a domain for around $6 if you're interested.


PulsarSL, have you got a link?
RRRREJMEEEEEPVKLWENFNVJKEEEEEAOLKAFKLXCFZAASDJXZTTTTTTTLSIOWJXMOKLAFJNNKFNXN
RAGRBAQEMHIGDJVDSEOXVIYCELFHWLELJFIENXLRATALSJFSLCYTKLASJDKMHGOVOKAJDNMNUITN
RRRRLJVEEEEECLYVYHNVPFTAEEEEEMWLMEIRNGLARWJAKJDFLWNTIERJMIPQWOTZEOCXKNUBNXCN
RJIRPOWEANFUSNCZVDVZNMSFEKLOEPZLDKDJWSAAAAAAAOERHJCTNCKFRIMVKSOFOMKMANREWNBN
RZUDRGXEEEEENFQIDVLQNCKNEEEEEDGLLLLLLAWIOSNCDARLODMTOEJXMILDFJROTKJSDNLVCZNN
Offline Profile Quote Post Goto Top
 
PulsarSL
Super member
[ *  *  *  * ]
Revelation
Aug 1 2006, 12:06 PM
I bet it is very hard to find this forum on Google!

Quote:
 
I can get a domain for around $6 if you're interested.


PulsarSL, have you got a link?

Well, not really... I have the developer hosting package from 1and1.com Domains are $6 with this package... So I could buy it and forward it to s13.invisionfree.com.

Pulsar
Offline Profile Quote Post Goto Top
 
loki
Advanced Member
[ *  *  * ]
I found this on google, but I don't remember what the search was.
c(x) = 3x3 + x2 + x + 2; Find the inverse
Offline Profile Quote Post Goto Top
 
1 user reading this topic (1 Guest and 0 Anonymous)
« Previous Topic · Community · Next Topic »
Add Reply