| Welcome to Crypto. We hope you enjoy your visit. You're currently viewing our forum as a guest. This means you are limited to certain areas of the board and there are some features you can't use. If you join our community, you'll be able to access member-only sections, and use many member-only features such as customizing your profile, sending personal messages, and voting in polls. Registration is simple, fast, and completely free. Join our community! If you're already a member please log in to your account to access all of our features: |
| CipherSheet Beta Testing; I need some help beta testing a new prog | |
|---|---|
| Topic Started: Aug 6 2008, 04:07 AM (271 Views) | |
| Donald | Aug 6 2008, 04:07 AM Post #1 |
|
Elite member
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
Hello folks! I need some help beta testing a new Cryptography related Java program. Here is the deal. I LOVE cracking Cryptograms by hand with just paper and pencil. But I HATE counting letters. So, I've written a program called CipherSheet that takes a cryptogram and produces a page with the cryptogram and all of the basic counting done for you so it is ready to solve. I'm an ACA member, so this program was designed to not only allow you to enter cryptograms by hand, but also to read in the "digital cons" format ACA file and convert them all into ciphersheets at once, ready to put into a folder and take with you wherever you go. The program can be downloaded here: http://www.mediafire.com/?wsjkrirf6ul It uses Java 6 features. If you don't have the latest version of Java, you can get it here: http://www.java.com/en/download/index.jsp To install the program simply unzip all of the files into a single folder. On many computers double clicking CipherSheet.jar will run the program. If it doesn't, go to the command prompt, navigate to the appropriate folder, and type: java -jar CipherSheet.jar The first thing you see when the program runs is a window like this: ![]() Select the "Enter By Hand" method if you want to enter cryptograms one at a time. Select the "Load from ACA File" method if you want to load an entire "digital cons" file. If you click the "Enter By Hand" button, you will see this screen: ![]()
A few notes: The pattern dictionary has been deliberately set up to exclude any patterns with more than 20 matches. Any more than that just clutters up your sheet with largely useless information. There are tools in CipherSheet (which I need to make easily accessible in the next version) that will allow you to build your own pattern dictionary with different parameters if you prefer. The reason I allow an option to encrypt pattern words is that pattern words can make cracking a cryptogram SO easy that they almost feel like cheating. With a simple Caesar shift I can ignore the pattern words until I get into a bind. Then easily unencrypt them if I'm having trouble. Now then, the resulting CipherSheet you create should look something like this: ![]() You will see your primary workspace all ready for you at the top of the page. The alphabet below that. Followed by the various reports you selected. Have fun cracking! Now then, if you want to convert an entire ACA "Digital Cons" file into CipherSheets, you should click the "Load from ACA File" at the begining. Then you will get to a screen that looks like this: ![]()
The rest of it is pretty much the same. I've included an example "Digital Cons" file. You are NOT supposed to redistribute the actual ACA digital cons file, so this is a made up example using cryptograms from the publicly available Lanaki "Classical Cryptography Course" Note that the standard ACA "Digital Cons" file does NOT include author/hint/key/title info. But if you ADD that by hand after the puzzle number, the program will read it and include it in the ciphersheet printout. Known bugs: I'm having trouble getting the PRINT function to work under Linux, but the WRITE TO FILE works great. Planned Improvements: The program needs a help file. And I want to add the option to print a second page with a longer and more useful "contact/Variety Of Contact" report. I have another program that generates ciphers and cryptograms from sources such as The Bible or Shakespeare's plays (Or any public domain work, such as Burroughs "Barsoom" series). I want to combine it with CipherSheet to produce as many cryptograms as your heart could desire. So, there it is. Any help debugging and suggesting improvements would be muchly appreciated. Feedback, including and perhaps ESPECIALLY negative feedback, is certainly requested. Thanks! |
![]() |
|
| Donald | Aug 6 2008, 04:06 PM Post #2 |
|
Elite member
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
BUG! Why do you always catch them right AFTER you release something. <sigh> When you do a "Load From ACA File", the "Write To File" function works just fine. BUT, the "PRINT" function has a bug. The Form Feed isn't happening between different CipherSheets. I'm not certain why. Could be a simple logic bug that can be fixed in a few minutes, or a major "Java doesn't DO that" mess. Anyway, be aware of it. Sorry! |
![]() |
|
| Revelation | Aug 6 2008, 06:55 PM Post #3 |
|
Administrator
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
When I start with Enter by hand and type random text as cipher and press print, the application dies. I'm using Sun Java 6, but maybe not the latest version. So I will try to update first.
Edited by Revelation, Aug 6 2008, 06:55 PM.
|
|
RRRREJMEEEEEPVKLWENFNVJKEEEEEAOLKAFKLXCFZAASDJXZTTTTTTTLSIOWJXMOKLAFJNNKFNXN RAGRBAQEMHIGDJVDSEOXVIYCELFHWLELJFIENXLRATALSJFSLCYTKLASJDKMHGOVOKAJDNMNUITN RRRRLJVEEEEECLYVYHNVPFTAEEEEEMWLMEIRNGLARWJAKJDFLWNTIERJMIPQWOTZEOCXKNUBNXCN RJIRPOWEANFUSNCZVDVZNMSFEKLOEPZLDKDJWSAAAAAAAOERHJCTNCKFRIMVKSOFOMKMANREWNBN RZUDRGXEEEEENFQIDVLQNCKNEEEEEDGLLLLLLAWIOSNCDARLODMTOEJXMILDFJROTKJSDNLVCZNN | |
![]() |
|
| Donald | Aug 6 2008, 09:53 PM Post #4 |
|
Elite member
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
Are you running under windows or linux? There seems to be a java problem with linux printing. Does the "write to file" function work? |
![]() |
|
| jdege | Aug 7 2008, 04:54 PM Post #5 |
|
Elite member
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
Running jre 1.5.0_6, on Windows XP, I get an error on startup:
Updated to jre 1.6.0_07, and it seems to work, but it's not writing any files. It doesn't crash, but no files show up. Edited by jdege, Aug 7 2008, 06:14 PM.
|
| When cryptography is outlawed, bayl bhgynjf jvyy unir cevinpl. | |
![]() |
|
| Revelation | Aug 7 2008, 05:37 PM Post #6 |
|
Administrator
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
I'm running Linux. Write to file crashes too
Edited by Revelation, Aug 7 2008, 05:37 PM.
|
|
RRRREJMEEEEEPVKLWENFNVJKEEEEEAOLKAFKLXCFZAASDJXZTTTTTTTLSIOWJXMOKLAFJNNKFNXN RAGRBAQEMHIGDJVDSEOXVIYCELFHWLELJFIENXLRATALSJFSLCYTKLASJDKMHGOVOKAJDNMNUITN RRRRLJVEEEEECLYVYHNVPFTAEEEEEMWLMEIRNGLARWJAKJDFLWNTIERJMIPQWOTZEOCXKNUBNXCN RJIRPOWEANFUSNCZVDVZNMSFEKLOEPZLDKDJWSAAAAAAAOERHJCTNCKFRIMVKSOFOMKMANREWNBN RZUDRGXEEEEENFQIDVLQNCKNEEEEEDGLLLLLLAWIOSNCDARLODMTOEJXMILDFJROTKJSDNLVCZNN | |
![]() |
|
| Donald | Aug 8 2008, 04:04 PM Post #7 |
|
Elite member
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
ugh, this is a problem. Are you using the "Select" button to select an output path? |
![]() |
|
| Revelation | Aug 9 2008, 01:46 PM Post #8 |
|
Administrator
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
I tested it with and without the select dialog. Both failed
|
|
RRRREJMEEEEEPVKLWENFNVJKEEEEEAOLKAFKLXCFZAASDJXZTTTTTTTLSIOWJXMOKLAFJNNKFNXN RAGRBAQEMHIGDJVDSEOXVIYCELFHWLELJFIENXLRATALSJFSLCYTKLASJDKMHGOVOKAJDNMNUITN RRRRLJVEEEEECLYVYHNVPFTAEEEEEMWLMEIRNGLARWJAKJDFLWNTIERJMIPQWOTZEOCXKNUBNXCN RJIRPOWEANFUSNCZVDVZNMSFEKLOEPZLDKDJWSAAAAAAAOERHJCTNCKFRIMVKSOFOMKMANREWNBN RZUDRGXEEEEENFQIDVLQNCKNEEEEEDGLLLLLLAWIOSNCDARLODMTOEJXMILDFJROTKJSDNLVCZNN | |
![]() |
|
| Donald | Aug 10 2008, 01:44 PM Post #9 |
|
Elite member
![]() ![]() ![]() ![]() ![]() ![]() ![]()
|
This is really odd. Could you send me a screen shot of what the panel looks like just before (and just after) you click "Write To File"??? |
![]() |
|
| 1 user reading this topic (1 Guest and 0 Anonymous) | |
| « Previous Topic · Community · Next Topic » |





![]](http://209.85.122.85/static/1/pip_r.png)







6:14 PM Nov 23